Table 1.

Schematic Representation and Molecular Properties of Chimeric trans-Sialidases

Schematic Representation and Molecular Properties of Chimeric trans-Sialidases
Schematic Representation Name MW Sp. Act. Net Charge No. of Repeats
H2N  TSac  75.9 0.56  −1.7  —  
H2TS-Ag 1  126.6  0.48  −25.7  
H2N  TS-Ag 13  113.7  0.77  −13.4 56  
H2N  TS-Ag 36  100.7 ND  −18.8  6  
H2TS-SAPA  94.6  1.09  −12.4  13 
H2N  TS-3R  78.5  0.65  −3.4 3  
H2N  TS-8R  84.2  0.61 −7.5  8  
H2N  TS-13R  91.7 ND  −12.5  13 
Schematic Representation Name MW Sp. Act. Net Charge No. of Repeats
H2N  TSac  75.9 0.56  −1.7  —  
H2TS-Ag 1  126.6  0.48  −25.7  
H2N  TS-Ag 13  113.7  0.77  −13.4 56  
H2N  TS-Ag 36  100.7 ND  −18.8  6  
H2TS-SAPA  94.6  1.09  −12.4  13 
H2N  TS-3R  78.5  0.65  −3.4 3  
H2N  TS-8R  84.2  0.61 −7.5  8  
H2N  TS-13R  91.7 ND  −12.5  13 

Different motifs present in chimeric trans-sialidases are indicated by boxes of different pattern. From N- to C-terminus: the pTrcHis fusion peptide (), the trans-sialidase domain responsible for the catalytic activity (empty box), and the variable repetitive domain (▨). TS-SAPA and TS-Ag 13 proteins contain an additional nonrepeated stretch of amino acids on their C-termini indicated by ▪. H2N denotes the N-terminus of every protein. MW are indicated in kD and specific activities (Sp. Act.) are indicated in U/nmol. Predicted net charge at pH 7 for each protein is indicated. ND for nondetermined. Hyphen denotes absence of repetitive units in TSac protein. Amino acid sequence of repetitive units are: antigen 1 (SMNARAQELAREKKLADRAFLDQKPEGVPLRELPLDDDSDFVAMEQERRQQLEKDPRRNAKEIAALEE; 68 amino acids), antigen 13 (EPKSA; 5 amino acids), antigen 36 (ALPQEEQEDVGPRHVD PDHFRSTTQDAYRPVDPSAYKR; 38 amino acids), and antigen SAPA (DSSAHSTPSTPA; 12 amino acids).

or Create an Account

Close Modal
Close Modal